GBL Antikörper

Produktnummer ABIN631915

Produktdetails anti-GBL Antikörper

Target: GBL (G protein beta subunit-like (GBL))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GBL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GBL antibody was raised using a synthetic peptide corresponding to a region with amino acids CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GBL Blocking Peptide, catalog no. 33R-1639, is also available for use as a blocking control in assays to test for specificity of this GBL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GBL

Target: GBL (G protein beta subunit-like (GBL))

Andere Bezeichnung: GBL (GBL Produkte)

Synonyme: gbl antikoerper, lts8 antikoerper, GBL antikoerper, GbetaL antikoerper, LST8 antikoerper, POP3 antikoerper, WAT1 antikoerper, 0610033N12Rik antikoerper, AA409454 antikoerper, AI505104 antikoerper, AI851821 antikoerper, Gbl antikoerper, fi37e04 antikoerper, wu:fi37e04 antikoerper, zgc:55455 antikoerper, zgc:85668 antikoerper, MTOR associated protein, LST8 homolog L homeolog antikoerper, MTOR associated protein, LST8 homolog antikoerper, MTOR associated protein, LST8 homolog (S. cerevisiae) antikoerper, mlst8.L antikoerper, MLST8 antikoerper, Mlst8 antikoerper, mlst8 antikoerper

Hintergrund: GBL is the subunit of both mTORC1 and mTORC2, which regulate cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino-acids. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg, RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Actin Filament Polymerization, Autophagie, CXCR4-mediated Signaling Events, BCR Signaling, Warburg Effekt