PRKACB Antikörper (Middle Region)

Produktnummer ABIN631277

Produktdetails anti-PRKACB Antikörper

Target: PRKACB (Protein Kinase, CAMP Dependent, Catalytic, beta (PRKACB))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRKACB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKACB antibody was raised against the middle region of PRKACB

Aufreinigung: Affinity purified

Immunogen: PRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKACB Blocking Peptide, catalog no. 33R-6712, is also available for use as a blocking control in assays to test for specificity of this PRKACB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKACB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRKACB

Target: PRKACB (Protein Kinase, CAMP Dependent, Catalytic, beta (PRKACB))

Andere Bezeichnung: PRKACB (PRKACB Produkte)

Synonyme: PKACB antikoerper, XPKAbeta antikoerper, kin-1 antikoerper, pkacb antikoerper, prkacba antikoerper, PRKACB antikoerper, prkacb antikoerper, wu:fz54b03 antikoerper, zgc:110804 antikoerper, Pkacb antikoerper, protein kinase cAMP-activated catalytic subunit beta antikoerper, protein kinase cAMP-activated catalytic subunit beta S homeolog antikoerper, protein kinase, cAMP-dependent, catalytic, beta antikoerper, protein kinase, cAMP-dependent, catalytic, beta b antikoerper, protein kinase, cAMP dependent, catalytic, beta antikoerper, PRKACB antikoerper, prkacb.S antikoerper, prkacb antikoerper, Prkacb antikoerper, prkacbb antikoerper

Hintergrund: CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: AMPK Signaling, Hedgehog Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, M Phase, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma, Lipid Metabolism