MAP2K7 Antikörper (Middle Region)

Produktnummer ABIN631268

Produktdetails anti-MAP2K7 Antikörper

Target: MAP2K7 (Mitogen-Activated Protein Kinase Kinase 7 (MAP2K7))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP2K7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAP2 K7 antibody was raised against the middle region of MAP2 7

Aufreinigung: Affinity purified

Immunogen: MAP2 K7 antibody was raised using the middle region of MAP2 7 corresponding to a region with amino acids ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP2K7 Blocking Peptide, catalog no. 33R-2695, is also available for use as a blocking control in assays to test for specificity of this MAP2K7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP2K7

Target: MAP2K7 (Mitogen-Activated Protein Kinase Kinase 7 (MAP2K7))

Andere Bezeichnung: MAP2K7 (MAP2K7 Produkte)

Synonyme: MAP2K7 antikoerper, 2 antikoerper, JNKK antikoerper, Jnkk2 antikoerper, Mapkk7 antikoerper, Mek7 antikoerper, Mkk7 antikoerper, MAPKK7 antikoerper, MKK7 antikoerper, PRKMK7 antikoerper, SAPKK-4 antikoerper, SAPKK4 antikoerper, 5930412N11Rik antikoerper, JNKK 2 antikoerper, MAPKK 7 antikoerper, MEK 7 antikoerper, Prkmk7 antikoerper, sek2 antikoerper, si:ch211-254d18.2 antikoerper, map2k7-A antikoerper, mitogen-activated protein kinase kinase 7 antikoerper, mitogen activated protein kinase kinase 7 antikoerper, mitogen-activated protein kinase kinase 7 L homeolog antikoerper, MAP2K7 antikoerper, Map2k7 antikoerper, map2k7 antikoerper, map2k7.L antikoerper

Hintergrund: MAP2K7 is a stress activated, dual specificity kinase that activates the JUN kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: MAPK Signalweg, TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Toll-Like Receptors Cascades, BCR Signaling