Insulin Antikörper

Produktnummer ABIN6290122

Produktdetails anti-Insulin Antikörper

Target: Insulin (INS)

Reaktivität: Human

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser Insulin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Sequenz: MFVNQHLCGS HLVEALYLVC GERGFFYTPK TGIVEQCCTS ICSLYQLENY CN

Spezifität: Gives a positive signal using MBP-Insulin recombinant fusion protein by WB.

Aufreinigung: This antibody is epitope-affinity purified from goat antiserum.

Immunogen: Recombinant human Insulin (MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN) produced in E. coli as a fusion protein.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot 1:250-1:2,000 Immunofluorescence ND Immunohistochemistry (paraffin) ND Immunohistochemistry (frozen) ND

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Konzentration: 3 mg/mL

Buffer: PBS, 20 % glycerol and 0.05 % sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: Store at -20°C, and avoid repeated freeze-thaw cycles.

Details zu Insulin

Target: Insulin (INS)

Andere Bezeichnung: INS (INS Produkte)

Synonyme: IDDM2 antikoerper, ILPR antikoerper, IRDN antikoerper, MODY10 antikoerper, ins1 antikoerper, xins antikoerper, ins1-a antikoerper, Insulin antikoerper, AA986540 antikoerper, Ins-2 antikoerper, InsII antikoerper, Mody antikoerper, Mody4 antikoerper, proinsulin antikoerper, zgc:109842 antikoerper, igf2-A antikoerper, ins antikoerper, ins-a antikoerper, ins-b antikoerper, insulin antikoerper, insulin precursor antikoerper, insulin II antikoerper, preproinsulin antikoerper, insulin L homeolog antikoerper, insulin S homeolog antikoerper, INS antikoerper, INS-IGF2 antikoerper, ins antikoerper, Ins antikoerper, PIN antikoerper, Ins2 antikoerper, ins.L antikoerper, ins.S antikoerper

Hintergrund: Goat polyclonal to Insulin. Insulin is a 6 kDa peptide, first synthesized as a precursor molecule, preproinsulin which is then processed into proinsulin and finally to the mature insulin. An increase in blood glucose levels during stimulates insulin release from pancreatic β cells. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake.

Molekulargewicht: 12 kDa

Gen-ID: 3630

UniProt: P01308

Pathways: NF-kappaB Signalweg, RTK Signalweg, Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, Hormone Activity, Carbohydrate Homeostasis, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Autophagie, Negative Regulation of intrinsic apoptotic Signaling, Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation