anti-Fruchtfliege (Drosophila melanogaster) LAT2 Antikörper für Immunohistochemistry

Recommended LAT2 Antibody

Antigen
Linker For Activation of T Cells Family, Member 2 (LAT2) Antikörper
  • LAB
  • NTAL
  • WBSCR15
  • WBSCR5
  • WSCR5
  • LAT2
  • MGC139435
  • Ntal
  • Wbscr5
  • AW125574
  • Wbscr15
  • linker for activation of T-cells family member 2
  • linker for activation of T cells family, member 2
  • LAT2
  • Lat2
Epitop
N-Term
16
15
11
11
11
10
9
8
7
6
5
5
5
5
2
2
2
2
2
1
1
1
1
1
Reaktivität
Fruchtfliege (Drosophila melanogaster)
124
43
31
3
3
2
1
1
1
1
1
Wirt
Kaninchen
108
29
14
Klonalität
Polyklonal
Konjugat
Dieser LAT2 Antikörper ist unkonjugiert
8
8
6
3
3
3
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
132
43
32
28
16
13
12
6
5
3
3
2
1
Optionen
Produktnummer ABIN630764
$ 449.29
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Clonality References Details
4 ABIN2463107 IHC ELISA WB Rabbit Polyclonal 0

General

Antigen Linker For Activation of T Cells Family, Member 2 (LAT2) Antikörper
Epitop N-Term
(16), (15), (11), (11), (11), (10), (9), (8), (7), (6), (5), (5), (5), (5), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reaktivität Fruchtfliege (Drosophila melanogaster)
(124), (43), (31), (3), (3), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(108), (29), (14)
Klonalität
Polyklonal
Konjugat Dieser LAT2 Antikörper ist unkonjugiert
(8), (8), (6), (3), (3), (3), (2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(132), (43), (32), (28), (16), (13), (12), (6), (5), (3), (3), (2), (1)
Hersteller

Produktdetails anti-LAT2 Antikörper

Target Details LAT2 Anwendungsinformationen Handhabung Bilder
Spezifität LAB antibody was raised against the N terminal Of Lab
Reinigung Affinity purified
Immunogen LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
Plasmids, Primers & others

Target Details LAT2

Produktdetails anti-LAT2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung LAB (LAT2 Antibody Abstract)
Hintergrund Lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.
Molekulargewicht 54 kDa (MW of target protein)
Pathways Fc-epsilon Rezeptor Signalübertragung

Anwendungsinformationen

Produktdetails anti-LAT2 Antikörper Target Details LAT2 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

LAB Blocking Peptide, catalog no. 33R-6229, is also available for use as a blocking control in assays to test for specificity of this LAB antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-LAT2 Antikörper Target Details LAT2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAB antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.