Growth Hormone Receptor Antikörper (N-Term)

Produktnummer ABIN635863

Produktdetails anti-Growth Hormone Receptor Antikörper

Target: Growth Hormone Receptor (GHR)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Growth Hormone Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GHR antibody was raised against the N terminal of GHR

Aufreinigung: Affinity purified

Immunogen: GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GHR Blocking Peptide, catalog no. 33R-5341, is also available for use as a blocking control in assays to test for specificity of this GHR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Growth Hormone Receptor

Target: Growth Hormone Receptor (GHR)

Andere Bezeichnung: GHR (GHR Produkte)

Synonyme: GHBP antikoerper, AA986417 antikoerper, GHR/BP antikoerper, GHR antikoerper, ghr antikoerper, ghr.a antikoerper, zgc:162141 antikoerper, growth hormone receptor antikoerper, growth hormone receptor L homeolog antikoerper, growth hormone receptor a antikoerper, GHR antikoerper, Ghr antikoerper, ghr.L antikoerper, ghr antikoerper, ghra antikoerper

Hintergrund: GHR is a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, JAK-STAT Signalweg, Response to Growth Hormone Stimulus