Growth Hormone Receptor Antikörper (N-Term)
-
- Target Alle Growth Hormone Receptor (GHR) Antikörper anzeigen
- Growth Hormone Receptor (GHR)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Growth Hormone Receptor Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GHR antibody was raised against the N terminal of GHR
- Aufreinigung
- Affinity purified
- Immunogen
- GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF
- Top Product
- Discover our top product GHR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GHR Blocking Peptide, catalog no. 33R-5341, is also available for use as a blocking control in assays to test for specificity of this GHR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Growth Hormone Receptor (GHR)
- Andere Bezeichnung
- GHR (GHR Produkte)
- Synonyme
- GHBP antikoerper, AA986417 antikoerper, GHR/BP antikoerper, GHR antikoerper, ghr antikoerper, ghr.a antikoerper, zgc:162141 antikoerper, growth hormone receptor antikoerper, growth hormone receptor L homeolog antikoerper, growth hormone receptor a antikoerper, GHR antikoerper, Ghr antikoerper, ghr.L antikoerper, ghr antikoerper, ghra antikoerper
- Hintergrund
- GHR is a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature.
- Molekulargewicht
- 70 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, JAK-STAT Signalweg, Response to Growth Hormone Stimulus
-