Cadherin 4 Antikörper
-
- Target Alle Cadherin 4 (CDH4) Antikörper anzeigen
- Cadherin 4 (CDH4)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cadherin 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CDH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSRGPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMEVFSIDSMSGRM
- Top Product
- Discover our top product CDH4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDH4 Blocking Peptide, catalog no. 33R-2616, is also available for use as a blocking control in assays to test for specificity of this CDH4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cadherin 4 (CDH4)
- Andere Bezeichnung
- CDH4 (CDH4 Produkte)
- Synonyme
- cad4 antikoerper, rcad antikoerper, R-cadherin antikoerper, cadherin-4 antikoerper, AW120700 antikoerper, R-Cadh antikoerper, Rcad antikoerper, Cdh4l antikoerper, zgc:136316 antikoerper, CAD4 antikoerper, RCAD antikoerper, cadherin 4 antikoerper, cadherin 4, type 1, R-cadherin (retinal) antikoerper, Cadherin-4 antikoerper, cdh4 antikoerper, Cdh4 antikoerper, CDH4 antikoerper, cdh-4 antikoerper
- Hintergrund
- CDH4 gene is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization.
- Molekulargewicht
- 82 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Regulation of Cell Size
-