GZMA Antikörper

Produktnummer ABIN634499

Produktdetails anti-GZMA Antikörper

Target: GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GZMA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Granzyme A antibody was raised using a synthetic peptide corresponding to a region with amino acids TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Granzyme A Blocking Peptide, catalog no. 33R-9256, is also available for use as a blocking control in assays to test for specificity of this Granzyme A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GZMA

Target: GZMA (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA))

Andere Bezeichnung: Granzyme A (GZMA Produkte)

Synonyme: gzmA antikoerper, GZMA antikoerper, AW494114 antikoerper, Ctla-3 antikoerper, Ctla3 antikoerper, Hf antikoerper, SE1 antikoerper, TSP-1 antikoerper, TSP1 antikoerper, CTLA3 antikoerper, HFSP antikoerper, granzyme A antikoerper, Granzyme A antikoerper, granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) antikoerper, gzmA antikoerper, GZMA antikoerper, graa antikoerper, Gzma antikoerper

Hintergrund: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Apoptose