PLK1 Antikörper
-
- Target Alle PLK1 Antikörper anzeigen
- PLK1 (Polo-Like Kinase 1 (PLK1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS
- Top Product
- Discover our top product PLK1 Primärantikörper
-
anti-Polo-Like Kinase 1 (PLK1) (AA 331-508) antibody
PLK1 Reaktivität: Human, Maus WB, ELISA, IHC, FACS Wirt: Maus Monoclonal 3C11 unconjugated
anti-Polo-Like Kinase 1 (PLK1) (AA 1-603) antibodyPLK1 Reaktivität: Human WB, ELISA, IF, IP, PLA Wirt: Maus Monoclonal 2G12 unconjugated
anti-Polo-Like Kinase 1 (PLK1) (AA 1-603) antibodyPLK1 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 4G11 unconjugated
anti-Polo-Like Kinase 1 (PLK1) (AA 304-603) antibodyPLK1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reaktivität: Human WB, IHC, IHC (p), IP, FACS Wirt: Maus Monoclonal 5C1 unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reaktivität: Human WB, IHC, IHC (p), IP Wirt: Maus Monoclonal 1D4 unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reaktivität: Human, Hund WB, IHC, IHC (p), IP Wirt: Maus Monoclonal 6C6 unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reaktivität: Human WB Wirt: Kaninchen Monoclonal unconjugated
anti-Polo-Like Kinase 1 (PLK1) (AA 205-214), (pThr210) antibodyPLK1 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reaktivität: Human, Hund, Affe WB, IF, IP, FACS Wirt: Maus Monoclonal 8C12 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLK1 Blocking Peptide, catalog no. 33R-4619, is also available for use as a blocking control in assays to test for specificity of this PLK1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLK1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLK1 (Polo-Like Kinase 1 (PLK1))
- Andere Bezeichnung
- PLK1 (PLK1 Produkte)
- Synonyme
- PLK antikoerper, STPK13 antikoerper, plk antikoerper, PLK-1 antikoerper, Plx1 antikoerper, stpk13 antikoerper, Plk antikoerper, cb525 antikoerper, cb636 antikoerper, ik:tdsubc_2d1 antikoerper, wu:fb37g11 antikoerper, wu:fb76g03 antikoerper, xx:tdsubc_2d1 antikoerper, polo like kinase 1 antikoerper, polo like kinase 1 S homeolog antikoerper, polo-like kinase 1 antikoerper, polo-like kinase 1 (Drosophila) antikoerper, Serine/threonine-protein kinase plk-1 antikoerper, PLK1 antikoerper, plk1.S antikoerper, plk1 antikoerper, Plk1 antikoerper, plk-1 antikoerper
- Hintergrund
- Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivation of APC/C inhibitors, and the regulation of mitotic exit and cytokinesis.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Zellzyklus, M Phase
-
