PRKACA Antikörper (N-Term)

Produktnummer ABIN633167

Produktdetails anti-PRKACA Antikörper

Target: PRKACA (Protein Kinase A, alpha (PRKACA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRKACA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKACA antibody was raised against the N terminal of PRKACA

Aufreinigung: Affinity purified

Immunogen: PRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKACA Blocking Peptide, catalog no. 33R-5754, is also available for use as a blocking control in assays to test for specificity of this PRKACA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKACA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRKACA

Target: PRKACA (Protein Kinase A, alpha (PRKACA))

Andere Bezeichnung: PRKACA (PRKACA Produkte)

Synonyme: PKACA antikoerper, Calpha antikoerper, Cs-PKA antikoerper, PKCA1 antikoerper, PKA antikoerper, PKCD antikoerper, Pkaca antikoerper, zgc:158799 antikoerper, protein kinase cAMP-activated catalytic subunit alpha antikoerper, protein kinase, cAMP dependent, catalytic, alpha antikoerper, cAMP-dependent protein kinase catalytic subunit antikoerper, protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a antikoerper, PRKACA antikoerper, Prkaca antikoerper, kin-1 antikoerper, prkacaa antikoerper

Hintergrund: CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, Hedgehog Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, Carbohydrate Homeostasis, Myometrial Relaxation and Contraction, M Phase, G-protein mediated Events, Signaling Events mediated by VEGFR1 and VEGFR2, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGFR1 Specific Signals, Lipid Metabolism, SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion