LAT2 Antikörper (N-Term)

Produktnummer ABIN630764

Produktdetails anti-LAT2 Antikörper

Target: LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))

Bindungsspezifität: N-Term

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LAT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: LAB antibody was raised against the N terminal Of Lab

Aufreinigung: Affinity purified

Immunogen: LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAB Blocking Peptide, catalog no. 33R-6229, is also available for use as a blocking control in assays to test for specificity of this LAB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LAT2

Target: LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))

Andere Bezeichnung: LAB (LAT2 Produkte)

Synonyme: LAB antikoerper, NTAL antikoerper, WBSCR15 antikoerper, WBSCR5 antikoerper, WSCR5 antikoerper, LAT2 antikoerper, MGC139435 antikoerper, Ntal antikoerper, Wbscr5 antikoerper, AW125574 antikoerper, Wbscr15 antikoerper, linker for activation of T-cells family member 2 antikoerper, linker for activation of T cells family, member 2 antikoerper, LAT2 antikoerper, Lat2 antikoerper

Hintergrund: Lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, BCR Signaling