LAT2 Antikörper (N-Term)
-
- Target Alle LAT2 Antikörper anzeigen
- LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LAT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- LAB antibody was raised against the N terminal Of Lab
- Aufreinigung
- Affinity purified
- Immunogen
- LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
- Top Product
- Discover our top product LAT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LAB Blocking Peptide, catalog no. 33R-6229, is also available for use as a blocking control in assays to test for specificity of this LAB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))
- Andere Bezeichnung
- LAB (LAT2 Produkte)
- Synonyme
- LAB antikoerper, NTAL antikoerper, WBSCR15 antikoerper, WBSCR5 antikoerper, WSCR5 antikoerper, LAT2 antikoerper, MGC139435 antikoerper, Ntal antikoerper, Wbscr5 antikoerper, AW125574 antikoerper, Wbscr15 antikoerper, linker for activation of T-cells family member 2 antikoerper, linker for activation of T cells family, member 2 antikoerper, LAT2 antikoerper, Lat2 antikoerper
- Hintergrund
- Lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.
- Molekulargewicht
- 54 kDa (MW of target protein)
- Pathways
- Fc-epsilon Rezeptor Signalübertragung, BCR Signaling
-