AIF Antikörper

Produktnummer ABIN4950058

Produktdetails anti-AIF Antikörper

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AIF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC)

Aufreinigung: Antigen affinity

Immunogen: Amino acids FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED of human AIF were used as the immunogen for the AIF antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the AIF antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,ICC: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the AIF antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu AIF

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Andere Bezeichnung: AIFM1 (AIFM1 Produkte)

Synonyme: AIF antikoerper, CMTX4 antikoerper, COWCK antikoerper, COXPD6 antikoerper, PDCD8 antikoerper, CG7263 antikoerper, DmAIF antikoerper, Dmel\\CG7263 antikoerper, GB16024 antikoerper, DDBDRAFT_0187853 antikoerper, DDBDRAFT_0191137 antikoerper, DDB_0187853 antikoerper, DDB_0191137 antikoerper, aif antikoerper, pdcd8 antikoerper, AIFM1 antikoerper, PCD8 antikoerper, AIFsh2 antikoerper, Hq antikoerper, Pdcd8 antikoerper, mAIF antikoerper, Aif antikoerper, zgc:91994 antikoerper, apoptosis inducing factor mitochondria associated 1 antikoerper, allograft inflammatory factor 1 antikoerper, Apoptosis inducing factor antikoerper, apoptosis-inducing factor 1, mitochondrial antikoerper, apoptosis inducing factor antikoerper, apoptosis inducing factor, mitochondria associated 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated, 1 antikoerper, apoptosis-inducing factor, mitochondrion-associated 1 antikoerper, AIFM1 antikoerper, AIF1 antikoerper, AIF antikoerper, LOC412212 antikoerper, aif antikoerper, aifm1 antikoerper, Aifm1 antikoerper

Hintergrund: Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.

UniProt: O95831

Pathways: Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effekt