PTPN11 Antikörper (N-Term)

Produktnummer ABIN3043912

Produktdetails anti-PTPN11 Antikörper

Target: PTPN11 (Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11))

Bindungsspezifität: AA 69-99, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTPN11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: EKFATLAELV QYYMEHHGQL KEKNGDVIEL K

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein tyrosine phosphatase, non-receptor type 11
Protein Name: Tyrosine-protein phosphatase non-receptor type 11

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PTPN11

Target: PTPN11 (Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11))

Andere Bezeichnung: PTPN11 (PTPN11 Produkte)

Synonyme: BPTP3 antikoerper, CFC antikoerper, NS1 antikoerper, PTP-1D antikoerper, PTP2C antikoerper, SH-PTP2 antikoerper, SH-PTP3 antikoerper, SHP2 antikoerper, 2700084A17Rik antikoerper, AW536184 antikoerper, PTP1D antikoerper, SAP-2 antikoerper, SHP-2 antikoerper, Shp2 antikoerper, Syp antikoerper, SYP antikoerper, bptp3 antikoerper, cfc antikoerper, ns1 antikoerper, ptp-2 antikoerper, ptp2c antikoerper, ptpn11 antikoerper, ptpn11-a antikoerper, ptpn11-b antikoerper, shp-2 antikoerper, shp2 antikoerper, fa14b09 antikoerper, wu:fa14b09 antikoerper, wu:fi24f03 antikoerper, zgc:55388 antikoerper, zgc:63553 antikoerper, protein tyrosine phosphatase, non-receptor type 11 antikoerper, protein tyrosine phosphatase, non-receptor type 11 S homeolog antikoerper, protein tyrosine phosphatase, non-receptor type 11, a antikoerper, protein tyrosine phosphatase, non-receptor type 11, b antikoerper, PTPN11 antikoerper, Ptpn11 antikoerper, ptpn11.S antikoerper, ptpn11a antikoerper, ptpn11b antikoerper

Substanzklasse: Viral Protein

Hintergrund: PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1,779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

Synonyms: BPTP 3 antibody|BPTP3 antibody|CFC antibody|MGC14433 antibody|Noonan syndrome 1 antibody|Noonan syndrome 1 protein tyrosine phosphatase 2C antibody|NS 1 antibody|NS1 antibody|OTTHUMP00000166107 antibody|OTTHUMP00000166108 antibody|Protein tyrosine phosphatase 2 antibody|Protein tyrosine phosphatase 2C antibody|Protein Tyrosine Phosphatase Non receptor Type 11 antibody|Protein-tyrosine phosphatase 1D antibody|Protein-tyrosine phosphatase 2C antibody|PTN11_HUMAN antibody|PTP 1D antibody|PTP 2C antibody|PTP-1D antibody|PTP-2C antibody|PTP1D antibody|PTP2C antibody|PTPN 11 antibody|PTPN11 antibody|PTPN11 antibody|SAP2 antibody|SH PTP2 antibody|SH PTP3 antibody|SH-PTP2 antibody|SH-PTP3 antibody|SH2 domain containing protein tyrosine phosphatase 2 antibody|SHIP2 antibody|SHP 2 antibody|SHP-2 antibody|Shp2 antibody|SHPTP 2 antibody|SHPTP2 antibody|SHPTP3 antibody|SIT protein precursor antibody| Syp antibody|Tyrosine protein phosphatase non receptor type 11 antibody|Tyrosine-protein phosphatase non-receptor type 11 antibody

Gen-ID: 5781

UniProt: Q06124

Pathways: JAK-STAT Signalweg, RTK Signalweg, T-Zell Rezeptor Signalweg, Interferon-gamma Pathway, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Toll-Like Receptors Cascades, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, BCR Signaling, Warburg Effekt