STAT3 Antikörper (AA 688-722)

Produktnummer ABIN210643

Produktdetails anti-STAT3 Antikörper

Target: STAT3 (Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3))

Bindungsspezifität: AA 688-722

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Schwein, Affe, Pferd, Hamster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STAT3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunoprecipitation (IP), Immunocytochemistry (ICC), Gel Shift (GS)

Spezifität: Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.

Homologie: Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%) Sheep (97%) Chicken (84%).

Aufreinigung: Protein A purified

Immunogen: Bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%), Sheep (97%), Chicken (84%).

Type of Immunogen: Fusion protein

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Approved: GS, ICC (10 μg/mL), IP, WB (2 - 4 μg/mL)

Usage: Suitable for use in Western Blot, Immunocytochemistry and Immunoprecipitation. Western Blot: 2-4 μg/mL detects STAT3 in RIPA lysates from EGF stimulated human A431 cells. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunocytochemistry: 10 μg/mL shows positive immunostaining for STAT 3 in A431 cells fixed with 95 % ethanol, 5 % acetic acid. Immunoprecipitation: 4 μg immunoprecipitates STAT 3 from 500 μg of EGF-stimulated A431 RIPA lysate. Gel Shift Assay: This antibody supershifts.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: 0.1 M Tris-glycine,  pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 40 % glycerol.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeat freeze-thaw cycles.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Details zu STAT3

Target: STAT3 (Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3))

Andere Bezeichnung: STAT3 (STAT3 Produkte)

Synonyme: 1110034C02Rik antikoerper, AW109958 antikoerper, Aprf antikoerper, APRF antikoerper, HIES antikoerper, Xstat3 antikoerper, aprf antikoerper, hies antikoerper, stat3 antikoerper, wu:fc15d02 antikoerper, wu:fl59g06 antikoerper, z-Stat3 antikoerper, signal transducer and activator of transcription 3 antikoerper, signal transduction and activation of transcription 3 antikoerper, signal transducer and activator of transcription 3, gene 1 L homeolog antikoerper, signal transducer and activator of transcription 3 (acute-phase response factor) antikoerper, STAT3 antikoerper, stat3 antikoerper, Stat3 antikoerper, stat3.1.L antikoerper

Hintergrund: Name/Gene ID: STAT3

Synonyms: STAT3, Acute-phase response factor, APRF, DNA-binding protein APRF, HIES

Gen-ID: 6774

UniProt: P40763

Pathways: JAK-STAT Signalweg, RTK Signalweg, Interferon-gamma Pathway, Neurotrophin Signalübertragung, Dopaminergic Neurogenesis, Response to Growth Hormone Stimulus, Carbohydrate Homeostasis, Stem Cell Maintenance, Hepatitis C, Protein targeting to Nucleus, Feeding Behaviour, CXCR4-mediated Signaling Events, Signaling of Hepatocyte Growth Factor Receptor