anti-Human CACNA1H Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended CACNA1H Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Calcium Channel, Voltage-Dependent, T Type, alpha 1H Subunit (CACNA1H) Antikörper
  • CACNA1HB
  • Cav3.2
  • ECA6
  • EIG6
  • MNCb-1209
  • alpha13.2
  • calcium voltage-gated channel subunit alpha1 H
  • calcium channel, voltage-dependent, T type, alpha 1H subunit
  • CACNA1H
  • Cacna1h
Reaktivität
Human
100
78
74
Wirt
Kaninchen
76
27
Klonalität
Polyklonal
Konjugat
Dieser CACNA1H Antikörper ist unkonjugiert
4
4
3
3
3
3
3
3
3
3
3
3
3
3
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
96
83
60
60
55
21
21
18
17
15
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4288334
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN447362 ICC IHC (fro) IF IHC (p) IP IHC WB Mouse IgG1 Anmelden zum Anzeigen S55-10 2
1 ABIN5689913 ELISA IF IHC (p) WB Rabbit IgG AA 1010-1060 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2617830 ELISA IF IHC IHC (p) WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN4288332 ICC IF IHC IHC (fro) IHC (p) IP WB Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5960529 IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2962091 IF IHC (p) ELISA WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN5630979 ICC IF IHC IHC (fro) IHC (p) WB Alexa Fluor 405 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630980 ICC IF IHC IHC (fro) IHC (p) WB Alexa Fluor 488 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630981 ICC IF IHC IHC (fro) IHC (p) WB Alexa Fluor 647 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630982 ICC IF IHC IHC (fro) IHC (p) WB Alexa Fluor 700 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630983 ICC IF IHC IHC (fro) IHC (p) WB Biotin Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630984 ICC IF IHC IHC (fro) IHC (p) WB DyLight 350 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630985 ICC IF IHC IHC (fro) IHC (p) WB DyLight 405 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630986 ICC IF IHC IHC (fro) IHC (p) WB DyLight 488 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630987 ICC IF IHC IHC (fro) IHC (p) WB DyLight 550 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630988 ICC IF IHC IHC (fro) IHC (p) WB DyLight 650 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630989 ICC IF IHC IHC (fro) IHC (p) WB DyLight 680 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630990 ICC IF IHC IHC (fro) IHC (p) WB DyLight 755 Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630991 ICC IF IHC IHC (fro) IHC (p) FITC Mouse IgG1 Anmelden zum Anzeigen S55-10 0
1 ABIN5630992 IHC IHC (fro) IHC (p) WB HRP Mouse IgG1 Anmelden zum Anzeigen S55-10 0

General

Antigen Calcium Channel, Voltage-Dependent, T Type, alpha 1H Subunit (CACNA1H) Antikörper
Reaktivität Human
(100), (78), (74)
Wirt Kaninchen
(76), (27)
Klonalität
Polyklonal
Konjugat Dieser CACNA1H Antikörper ist unkonjugiert
(4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(96), (83), (60), (60), (55), (21), (21), (18), (17), (15), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CACNA1H Antikörper

Target Details CACNA1H Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP
Isotyp IgG
Plasmids, Primers & others

Target Details CACNA1H

Produktdetails anti-CACNA1H Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Cav3.2 (CACNA1H Antibody Abstract)
Hintergrund Gene Symbol: CACNA1H
Gen-ID 8912
Pathways C21-Steroid Hormone Metabolic Process

Anwendungsinformationen

Produktdetails anti-CACNA1H Antikörper Target Details CACNA1H Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CACNA1H Antikörper Target Details CACNA1H Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CACNA1H Antikörper Target Details CACNA1H Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Calcium Channel, Voltage-Dependent, T Type, alpha 1H Subunit (CACNA1H) antibody (ABIN4288334) Immunohistochemistry: Cav3.2 Antibody [NBP1-88176] - Staining of human placenta shows...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Calcium Channel, Voltage-Dependent, T Type, alpha 1H Subunit (CACNA1H) antibody (ABIN4288334) Immunohistochemistry-Paraffin: Cav3.2 Antibody - Staining of human testis shows cyto...
Immunofluorescence (IF) image for anti-Calcium Channel, Voltage-Dependent, T Type, alpha 1H Subunit (CACNA1H) antibody (ABIN4288334) Immunocytochemistry/Immunofluorescence: Cav3.2 Antibody - Staining of human cell lin...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium Channel, Voltage-Dependent, T Type, alpha 1H Subunit (CACNA1H) antibody (ABIN4288334) Immunohistochemistry-Paraffin: Cav3.2 Antibody - Staining of human hippocampus shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium Channel, Voltage-Dependent, T Type, alpha 1H Subunit (CACNA1H) antibody (ABIN4288334) Immunohistochemistry-Paraffin: Cav3.2 Antibody - Staining of human tonsil shows only...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium Channel, Voltage-Dependent, T Type, alpha 1H Subunit (CACNA1H) antibody (ABIN4288334) Immunohistochemistry-Paraffin: Cav3.2 Antibody - Staining of human prostate shows mo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium Channel, Voltage-Dependent, T Type, alpha 1H Subunit (CACNA1H) antibody (ABIN4288334) Immunohistochemistry-Paraffin: Cav3.2 Antibody - Staining of human urothelium shows ...