WNT4 Antikörper (Middle Region)

Produktnummer ABIN636044

Produktdetails anti-WNT4 Antikörper

Target: WNT4 (Wingless-Type MMTV Integration Site Family, Member 4 (WNT4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WNT4 antibody was raised against the middle region of WNT4

Aufreinigung: Affinity purified

Immunogen: WNT4 antibody was raised using the middle region of WNT4 corresponding to a region with amino acids HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT4 Blocking Peptide, catalog no. 33R-3744, is also available for use as a blocking control in assays to test for specificity of this WNT4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT4

Target: WNT4 (Wingless-Type MMTV Integration Site Family, Member 4 (WNT4))

Andere Bezeichnung: WNT4 (WNT4 Produkte)

Synonyme: CG4698 antikoerper, DWnt-4 antikoerper, DWnt4 antikoerper, Dm DWnt4 antikoerper, Dmel\\CG4698 antikoerper, Dwnt4 antikoerper, Wnt antikoerper, Wnt-4 antikoerper, anon-EST:Liang-2.4 antikoerper, clone 2.4 antikoerper, wnt-4 antikoerper, wnt4 antikoerper, SERKAL antikoerper, WNT-4 antikoerper, Xwnt4 antikoerper, xwnt-4 antikoerper, zgc:136737 antikoerper, Wnt family member 4 antikoerper, Wnt oncogene analog 4 antikoerper, wingless-type MMTV integration site family, member 4 antikoerper, wingless-type MMTV integration site family member 4 S homeolog antikoerper, wingless-type MMTV integration site family, member 4a antikoerper, WNT4 antikoerper, Wnt4 antikoerper, wnt4.S antikoerper, wnt4a antikoerper

Hintergrund: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: WNT Signalweg, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Cell-Cell Junction Organization, Tube Formation