ACVR2B Antikörper (Middle Region)
-
- Target Alle ACVR2B Antikörper anzeigen
- ACVR2B (Activin A Receptor, Type IIB (ACVR2B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACVR2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACVR2 B antibody was raised against the middle region of ACVR2
- Aufreinigung
- Affinity purified
- Immunogen
- ACVR2 B antibody was raised using the middle region of ACVR2 corresponding to a region with amino acids LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV
- Top Product
- Discover our top product ACVR2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACVR2B Blocking Peptide, catalog no. 33R-4822, is also available for use as a blocking control in assays to test for specificity of this ACVR2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACVR2B (Activin A Receptor, Type IIB (ACVR2B))
- Andere Bezeichnung
- ACVR2B (ACVR2B Produkte)
- Synonyme
- ACVR2B antikoerper, XAR1 antikoerper, actr-iib antikoerper, actriib antikoerper, ACTRIIB antikoerper, ActR-IIB antikoerper, HTX4 antikoerper, ActRIIB antikoerper, actr2b antikoerper, actrIIb antikoerper, wu:fj97d11 antikoerper, activin A receptor type 2B antikoerper, activin A receptor type 2B L homeolog antikoerper, activin A receptor type 2Ba antikoerper, activin receptor IIB antikoerper, ACVR2B antikoerper, acvr2b antikoerper, acvr2b.L antikoerper, Acvr2b antikoerper, acvr2ba antikoerper
- Hintergrund
- Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- Hormone Transport, Cancer Immune Checkpoints
-