WNT1 Antikörper (Middle Region)

Produktnummer ABIN635697

Produktdetails anti-WNT1 Antikörper

Target: WNT1 (Wingless-Type MMTV Integration Site Family, Member 1 (WNT1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WNT1 antibody was raised against the middle region of WNT1

Aufreinigung: Affinity purified

Immunogen: WNT1 antibody was raised using the middle region of WNT1 corresponding to a region with amino acids FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT1 Blocking Peptide, catalog no. 33R-2912, is also available for use as a blocking control in assays to test for specificity of this WNT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT1

Target: WNT1 (Wingless-Type MMTV Integration Site Family, Member 1 (WNT1))

Andere Bezeichnung: WNT1 (WNT1 Produkte)

Synonyme: Xint-1 antikoerper, Xwnt1 antikoerper, int-1 antikoerper, int1 antikoerper, wnt-1 antikoerper, wnt1-a antikoerper, Int-1 antikoerper, Wnt-1 antikoerper, sw antikoerper, swaying antikoerper, BMND16 antikoerper, INT1 antikoerper, OI15 antikoerper, Int1 antikoerper, WNT-1 antikoerper, sb:eu647 antikoerper, zgc:194464 antikoerper, zgc:194478 antikoerper, WNT1 antikoerper, Wnt family member 1 antikoerper, Wnt family member 1 L homeolog antikoerper, wingless-type MMTV integration site family, member 1 antikoerper, WNT1 antikoerper, wnt1.L antikoerper, Wnt1 antikoerper, wnt1 antikoerper

Hintergrund: WNT1 is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT1 is very conserved in evolution, and it is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: WNT Signalweg, Dopaminergic Neurogenesis