PTPN1 Antikörper (Middle Region)

Produktnummer ABIN635198

Produktdetails anti-PTPN1 Antikörper

Target: PTPN1 (Protein tyrosine Phosphatase, Non-Receptor Type 1 (PTPN1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTPN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTPN1 antibody was raised against the middle region of PTPN1

Aufreinigung: Affinity purified

Immunogen: PTPN1 antibody was raised using the middle region of PTPN1 corresponding to a region with amino acids SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTPN1 Blocking Peptide, catalog no. 33R-8491, is also available for use as a blocking control in assays to test for specificity of this PTPN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTPN1

Target: PTPN1 (Protein tyrosine Phosphatase, Non-Receptor Type 1 (PTPN1))

Andere Bezeichnung: PTPN1 (PTPN1 Produkte)

Synonyme: PTPN1 antikoerper, PTP1B antikoerper, PTP-1B antikoerper, PTP-HA2 antikoerper, Ptp antikoerper, ptp1b antikoerper, wu:fk54h03 antikoerper, CPTP1 antikoerper, protein tyrosine phosphatase, non-receptor type 1 antikoerper, protein tyrosine phosphatase, non-receptor type 1 L homeolog antikoerper, PTPN1 antikoerper, Ptpn1 antikoerper, ptpn1 antikoerper, ptpn1.L antikoerper

Hintergrund: PTPN1 is the founding member of the protein tyrosine phosphatase (PTP) family. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: TLR Signalweg, Response to Growth Hormone Stimulus, ER-Nucleus Signaling, Platelet-derived growth Factor Receptor Signaling