ALDH6A1 Antikörper (Middle Region)
-
- Target Alle ALDH6A1 Antikörper anzeigen
- ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDH6A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALDH6 A1 antibody was raised against the middle region of ALDH6 1
- Aufreinigung
- Affinity purified
- Immunogen
- ALDH6 A1 antibody was raised using the middle region of ALDH6 1 corresponding to a region with amino acids GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW
- Top Product
- Discover our top product ALDH6A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALDH6A1 Blocking Peptide, catalog no. 33R-3518, is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))
- Andere Bezeichnung
- ALDH6A1 (ALDH6A1 Produkte)
- Synonyme
- MMSADHA antikoerper, MMSDH antikoerper, Mmsdh antikoerper, cb850 antikoerper, wu:fb03a04 antikoerper, zgc:92082 antikoerper, 1110038I05Rik antikoerper, AI314632 antikoerper, aldehyde dehydrogenase 6 family member A1 antikoerper, aldehyde dehydrogenase 6 family, member A1 antikoerper, aldehyde dehydrogenase 6 family member A1 L homeolog antikoerper, methylmalonic acid semialdehyde dehydrogenase antikoerper, methylmalonate-semialdehyde dehydrogenase (CoA acylating) antikoerper, aldehyde dehydrogenase family 6, subfamily A1 antikoerper, ALDH6A1 antikoerper, Aldh6a1 antikoerper, aldh6a1.L antikoerper, CCNA_02357 antikoerper, aldh6a1 antikoerper, VAA_RS07845 antikoerper
- Hintergrund
- ALDH6A1 plays a role in valine and pyrimidine metabolism. ALDH6A1 binds fatty acyl-CoA. This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.
- Molekulargewicht
- 54 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-