ATP2A2 Antikörper (C-Term)

Produktnummer ABIN634681

Produktdetails anti-ATP2A2 Antikörper

Target: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP2A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP2 A2 antibody was raised against the C terminal of ATP2 2

Aufreinigung: Affinity purified

Immunogen: ATP2 A2 antibody was raised using the C terminal of ATP2 2 corresponding to a region with amino acids VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP2A2 Blocking Peptide, catalog no. 33R-9709, is also available for use as a blocking control in assays to test for specificity of this ATP2A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP2A2

Target: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Andere Bezeichnung: ATP2A2 (ATP2A2 Produkte)

Synonyme: atp2b antikoerper, ca-p60a antikoerper, dar antikoerper, serca2 antikoerper, ATP2A2 antikoerper, ATP2B antikoerper, DAR antikoerper, DD antikoerper, SERCA2 antikoerper, SERCA2A antikoerper, ATP2 antikoerper, Serca2 antikoerper, SercaII antikoerper, 9530097L16Rik antikoerper, D5Wsu150e antikoerper, SERCA2B antikoerper, mKIAA4195 antikoerper, atp2a2 antikoerper, zgc:55380 antikoerper, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 S homeolog antikoerper, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 antikoerper, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 antikoerper, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2a antikoerper, atp2a1.S antikoerper, ATP2A2 antikoerper, Atp2a2 antikoerper, atp2a2a antikoerper

Hintergrund: ATP2A2 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.

Molekulargewicht: 115 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process