ATP2A2 Antikörper (N-Term)

Produktnummer ABIN3030067

Produktdetails anti-ATP2A2 Antikörper

Target: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP2A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: An amino acid sequence from the N-terminus of human ATP2A2 (MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) was used as the immunogen for this ATP2A2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: The stated application concentrations are suggested starting amounts. Titration of the ATP2A2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ATP2A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ATP2A2

Target: ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))

Andere Bezeichnung: ATP2A2 (ATP2A2 Produkte)

Synonyme: atp2b antikoerper, ca-p60a antikoerper, dar antikoerper, serca2 antikoerper, ATP2A2 antikoerper, ATP2B antikoerper, DAR antikoerper, DD antikoerper, SERCA2 antikoerper, SERCA2A antikoerper, ATP2 antikoerper, Serca2 antikoerper, SercaII antikoerper, 9530097L16Rik antikoerper, D5Wsu150e antikoerper, SERCA2B antikoerper, mKIAA4195 antikoerper, atp2a2 antikoerper, zgc:55380 antikoerper, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 S homeolog antikoerper, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 antikoerper, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 antikoerper, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2a antikoerper, atp2a1.S antikoerper, ATP2A2 antikoerper, Atp2a2 antikoerper, atp2a2a antikoerper

Hintergrund: SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles, germinative and mature cells of sebaceous glands, secretory coil and duct of eccrine glands, apocrine gland cells, and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.

Gen-ID: 488

Pathways: Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process