PPP2R1A Antikörper

Produktnummer ABIN634652

Produktdetails anti-PPP2R1A Antikörper

Target: PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP2R1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP2R1A Blocking Peptide, catalog no. 33R-4262, is also available for use as a blocking control in assays to test for specificity of this PPP2R1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP2R1A

Target: PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))

Andere Bezeichnung: PPP2R1A (PPP2R1A Produkte)

Synonyme: PP2A-Aalpha antikoerper, PP2AAALPHA antikoerper, PR65A antikoerper, PR65 antikoerper, pp2a-aalpha antikoerper, pp2aaalpha antikoerper, ppp2r1a antikoerper, pr65a antikoerper, wu:fa02h04 antikoerper, zgc:56296 antikoerper, 6330556D22Rik antikoerper, PP2A antikoerper, ppp2r1a-a antikoerper, ppp2r1a-b antikoerper, protein phosphatase 2 scaffold subunit Aalpha antikoerper, protein phosphatase 2 scaffold subunit A alpha antikoerper, protein phosphatase 2 regulatory subunit A, alpha L homeolog antikoerper, protein phosphatase 2 regulatory subunit A, alpha antikoerper, protein phosphatase 2, regulatory subunit A, beta a antikoerper, serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform antikoerper, protein phosphatase 2, regulatory subunit A, alpha isoform antikoerper, protein phosphatase 2, regulatory subunit A, alpha antikoerper, protein phosphatase 2 regulatory subunit A, alpha S homeolog antikoerper, PPP2R1A antikoerper, Ppp2r1a antikoerper, ppp2r1a.L antikoerper, ppp2r1a antikoerper, ppp2r1ba antikoerper, LOC583227 antikoerper, ppp2r1a.S antikoerper

Hintergrund: PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. PPP2R1A is an alpha isoform of the constant regulatory subunit A.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg, Mitotic G1-G1/S Phases, M Phase, Hepatitis C, Toll-Like Receptors Cascades