ATG5 Antikörper

Produktnummer ABIN634588

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ATG5 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für ATG5 Antikörper (ABIN634588)

Target: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATG5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ATG5 Antikörper

Aufreinigung: Affinity purified

Immunogen: ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATG5 Blocking Peptide, (ABIN937485), is also available for use as a blocking control in assays to test for specificity of this ATG5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATG5

Target: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Andere Bezeichnung: ATG5

Hintergrund: ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Autophagie