ATG5 Antikörper

Produktnummer ABIN634588

Produktdetails anti-ATG5 Antikörper

Target: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATG5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATG5 Blocking Peptide, catalog no. 33R-2099, is also available for use as a blocking control in assays to test for specificity of this ATG5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATG5

Target: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Andere Bezeichnung: ATG5 (ATG5 Produkte)

Synonyme: APG5 antikoerper, APG5-LIKE antikoerper, APG5L antikoerper, ASP antikoerper, hAPG5 antikoerper, ATG5 antikoerper, CG1643 antikoerper, DmAtg5 antikoerper, Dmel\\CG1643 antikoerper, atg5 antikoerper, 2010107M05Rik antikoerper, 3110067M24Rik antikoerper, AW319544 antikoerper, Apg5l antikoerper, Atg5l antikoerper, C88337 antikoerper, Paddy antikoerper, apg5l antikoerper, zgc:100934 antikoerper, ATATG5 antikoerper, AUTOPHAGY 5 antikoerper, MKP11.20 antikoerper, MKP11_20 antikoerper, autophagy related 5 antikoerper, Autophagy-related 5 antikoerper, ATG5 autophagy related 5 homolog (S. cerevisiae) antikoerper, autophagy related 5 L homeolog antikoerper, similar to S. cerevisiae ATG5 (YPL149W) which nucleates preautophagosome formation as a conjugate with Atg12 antikoerper, autophagy protein Apg5 family antikoerper, ATG5 antikoerper, Atg5 antikoerper, atg5 antikoerper, atg5.L antikoerper, APG5 antikoerper

Hintergrund: ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Autophagie