CFP Antikörper (Middle Region)
-
- Target Alle CFP Antikörper anzeigen
- CFP (Complement Factor P (CFP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CFP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CFP antibody was raised against the middle region of CFP
- Aufreinigung
- Affinity purified
- Immunogen
- CFP antibody was raised using the middle region of CFP corresponding to a region with amino acids SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE
- Top Product
- Discover our top product CFP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CFP Blocking Peptide, catalog no. 33R-8645, is also available for use as a blocking control in assays to test for specificity of this CFP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CFP (Complement Factor P (CFP))
- Andere Bezeichnung
- CFP (CFP Produkte)
- Synonyme
- BFD antikoerper, PFC antikoerper, PFD antikoerper, PROPERDIN antikoerper, BCFG antikoerper, Pfc antikoerper, Properdin antikoerper, complement factor properdin antikoerper, CFP antikoerper, Cfp antikoerper
- Hintergrund
- CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Komplementsystem
-