LBP Antikörper (Middle Region)
-
- Target Alle LBP Antikörper anzeigen
- LBP (Lipopolysaccharide Binding Protein (LBP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LBP antibody was raised against the middle region of LBP
- Aufreinigung
- Affinity purified
- Immunogen
- LBP antibody was raised using the middle region of LBP corresponding to a region with amino acids LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV
- Top Product
- Discover our top product LBP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LBP Blocking Peptide, catalog no. 33R-5143, is also available for use as a blocking control in assays to test for specificity of this LBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LBP (Lipopolysaccharide Binding Protein (LBP))
- Andere Bezeichnung
- LBP (LBP Produkte)
- Synonyme
- BPIFD2 antikoerper, Bpifd2 antikoerper, Ly88 antikoerper, LPSBP antikoerper, LBP antikoerper, lipopolysaccharide binding protein antikoerper, lipopolysaccharide-binding protein antikoerper, LBP antikoerper, Lbp antikoerper, LOC100472839 antikoerper
- Hintergrund
- LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Toll-Like Receptors Cascades, Monocarboxylic Acid Catabolic Process
-