ARAF Antikörper (Middle Region)
-
- Target Alle ARAF Antikörper anzeigen
- ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARAF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARAF antibody was raised against the middle region of ARAF
- Aufreinigung
- Affinity purified
- Immunogen
- ARAF antibody was raised using the middle region of ARAF corresponding to a region with amino acids PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW
- Top Product
- Discover our top product ARAF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARAF Blocking Peptide, catalog no. 33R-7324, is also available for use as a blocking control in assays to test for specificity of this ARAF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARAF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))
- Andere Bezeichnung
- ARAF (ARAF Produkte)
- Synonyme
- zgc:92074 antikoerper, wu:fk45h07 antikoerper, ARAF antikoerper, a-raf antikoerper, araf antikoerper, araf1 antikoerper, pks2 antikoerper, rafa1 antikoerper, A-RAF antikoerper, ARAF1 antikoerper, PKS2 antikoerper, RAFA1 antikoerper, 1200013E08Rik antikoerper, A-Raf antikoerper, AW495444 antikoerper, Araf1 antikoerper, A-Raf proto-oncogene, serine/threonine kinase antikoerper, A-Raf proto-oncogene, serine/threonine kinase L homeolog antikoerper, A-Raf proto-oncogene, serine/threonine kinase S homeolog antikoerper, Araf proto-oncogene, serine/threonine kinase antikoerper, araf antikoerper, ARAF antikoerper, araf.L antikoerper, araf.S antikoerper, Araf antikoerper
- Hintergrund
- ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- MAPK Signalweg, RTK Signalweg, Hepatitis C
-