ARAF Antikörper (Middle Region)

Produktnummer ABIN634291

Produktdetails anti-ARAF Antikörper

Target: ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARAF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARAF antibody was raised against the middle region of ARAF

Aufreinigung: Affinity purified

Immunogen: ARAF antibody was raised using the middle region of ARAF corresponding to a region with amino acids PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARAF Blocking Peptide, catalog no. 33R-7324, is also available for use as a blocking control in assays to test for specificity of this ARAF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARAF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARAF

Target: ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))

Andere Bezeichnung: ARAF (ARAF Produkte)

Synonyme: zgc:92074 antikoerper, wu:fk45h07 antikoerper, ARAF antikoerper, a-raf antikoerper, araf antikoerper, araf1 antikoerper, pks2 antikoerper, rafa1 antikoerper, A-RAF antikoerper, ARAF1 antikoerper, PKS2 antikoerper, RAFA1 antikoerper, 1200013E08Rik antikoerper, A-Raf antikoerper, AW495444 antikoerper, Araf1 antikoerper, A-Raf proto-oncogene, serine/threonine kinase antikoerper, A-Raf proto-oncogene, serine/threonine kinase L homeolog antikoerper, A-Raf proto-oncogene, serine/threonine kinase S homeolog antikoerper, Araf proto-oncogene, serine/threonine kinase antikoerper, araf antikoerper, ARAF antikoerper, araf.L antikoerper, araf.S antikoerper, Araf antikoerper

Hintergrund: ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: MAPK Signalweg, RTK Signalweg, Hepatitis C