14-3-3 sigma/SFN Antikörper (Middle Region)
-
- Target Alle 14-3-3 sigma/SFN (SFN) Antikörper anzeigen
- 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser 14-3-3 sigma/SFN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SFN antibody was raised against the middle region of SFN
- Aufreinigung
- Affinity purified
- Immunogen
- SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT
- Top Product
- Discover our top product SFN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFN Blocking Peptide, catalog no. 33R-2923, is also available for use as a blocking control in assays to test for specificity of this SFN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))
- Andere Bezeichnung
- SFN (SFN Produkte)
- Synonyme
- YWHAS antikoerper, Er antikoerper, Mme1 antikoerper, Ywhas antikoerper, stratifin antikoerper, SFN antikoerper, Sfn antikoerper
- Hintergrund
- SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- p53 Signalweg, Myometrial Relaxation and Contraction
-