14-3-3 sigma/SFN Antikörper (Middle Region)

Produktnummer ABIN634143

Der Kaninchen Polyklonal anti-14-3-3 sigma/SFN Antikörper (ABIN634143) detektiert spezifisch 14-3-3 sigma/SFN in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für 14-3-3 sigma/SFN Antikörper (Middle Region) (ABIN634143)

Target: 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser 14-3-3 sigma/SFN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-14-3-3 sigma/SFN Antikörper

Bindungsspezifität: Middle Region

Spezifität: SFN antibody was raised against the middle region of SFN

Aufreinigung: Affinity purified

Immunogen: SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFN Blocking Peptide, (ABIN938309), is also available for use as a blocking control in assays to test for specificity of this SFN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu 14-3-3 sigma/SFN

Target: 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))

Andere Bezeichnung: SFN

Hintergrund: SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: p53 Signalweg, Myometrial Relaxation and Contraction