AGR2 Antikörper

Produktnummer ABIN634016

Produktdetails anti-AGR2 Antikörper

Target: AGR2 (Anterior Gradient Homolog 2 (Xenopus Laevis) (AGR2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: AGR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AGR2 Blocking Peptide, catalog no. 33R-1144, is also available for use as a blocking control in assays to test for specificity of this AGR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGR2

Target: AGR2 (Anterior Gradient Homolog 2 (Xenopus Laevis) (AGR2))

Andere Bezeichnung: AGR2 (AGR2 Produkte)

Synonyme: AG2 antikoerper, GOB-4 antikoerper, HAG-2 antikoerper, PDIA17 antikoerper, XAG-2 antikoerper, Agr2h antikoerper, Gob-4 antikoerper, mAG-2 antikoerper, wu:fj29g05 antikoerper, zgc:112187 antikoerper, agr2 antikoerper, hag3 antikoerper, hag-3 antikoerper, bcmp11 antikoerper, MGC89004 antikoerper, XAgr2 antikoerper, agr2-A antikoerper, anterior gradient 2, protein disulphide isomerase family member antikoerper, anterior gradient 2 antikoerper, anterior gradient 3, protein disulphide isomerase family member antikoerper, anterior gradient 2, protein disulphide isomerase family member S homeolog antikoerper, AGR2 antikoerper, Agr2 antikoerper, agr2 antikoerper, agr3 antikoerper, agr2.S antikoerper

Hintergrund: AGR2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan. Increased AGR2 expression is a valuable prognostic factor to predict the clinical outcome of the prostate cancer patients.

Molekulargewicht: 20 kDa (MW of target protein)