-
- Target Alle PRR5 Antikörper anzeigen
- PRR5 (Proline Rich 5 (Renal) (PRR5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRR5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PRR5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGS
- Top Product
- Discover our top product PRR5 Primärantikörper
-
anti-Proline Rich 5 (Renal) (PRR5) (AA 109-388) antibody
PRR5 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Proline Rich 5 (Renal) (PRR5) (AA 277-305), (C-Term) antibodyPRR5 Reaktivität: Maus WB Wirt: Kaninchen Polyclonal RB40277 unconjugated
anti-Proline Rich 5 (Renal) (PRR5) (AA 35-84) antibodyPRR5 Reaktivität: Human, Pferd, Rind (Kuh), Hund, Kaninchen, Schwein, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Proline Rich 5 (Renal) (PRR5) (C-Term) antibodyPRR5 Reaktivität: Human, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-Proline Rich 5 (Renal) (PRR5) (N-Term) antibodyPRR5 Reaktivität: Human, Maus, Ratte, Pferd, Rind (Kuh), Hund, Kaninchen, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRR5 Blocking Peptide, catalog no. 33R-3387, is also available for use as a blocking control in assays to test for specificity of this PRR5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRR5 (Proline Rich 5 (Renal) (PRR5))
- Andere Bezeichnung
- PRR5 (PRR5 Produkte)
- Synonyme
- AU043908 antikoerper, Arhgap8 antikoerper, C030017C09Rik antikoerper, C78947 antikoerper, Protor-1 antikoerper, Protor1 antikoerper, FLJ20185k antikoerper, PP610 antikoerper, PROTOR-1 antikoerper, PROTOR1 antikoerper, pp610 antikoerper, protor1 antikoerper, protor2 antikoerper, proline rich 5 (renal) antikoerper, proline rich 5 antikoerper, proline rich 5 L homeolog antikoerper, Prr5 antikoerper, PRR5 antikoerper, prr5.L antikoerper
- Hintergrund
- This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signalweg
-
Sie sind hier:
