KCNQ2 Antikörper (N-Term)
-
- Target Alle KCNQ2 Antikörper anzeigen
- KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Ratte, Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNQ2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNQ2 antibody was raised against the N terminal of KCNQ2
- Aufreinigung
- Affinity purified
- Immunogen
- KCNQ2 antibody was raised using the N terminal of KCNQ2 corresponding to a region with amino acids IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL
- Top Product
- Discover our top product KCNQ2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNQ2 Blocking Peptide, catalog no. 33R-3916, is also available for use as a blocking control in assays to test for specificity of this KCNQ2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))
- Andere Bezeichnung
- KCNQ2 (KCNQ2 Produkte)
- Synonyme
- BFNC antikoerper, BFNS1 antikoerper, EBN antikoerper, EBN1 antikoerper, EIEE7 antikoerper, ENB1 antikoerper, HNSPC antikoerper, KCNA11 antikoerper, KV7.2 antikoerper, KVEBN1 antikoerper, KQT2 antikoerper, Nmf134 antikoerper, mKQT2.3 antikoerper, mKQT2.4 antikoerper, zgc:171872 antikoerper, potassium voltage-gated channel subfamily Q member 2 antikoerper, potassium voltage-gated channel, subfamily Q, member 2 antikoerper, potassium voltage-gated channel subfamily KQT member 2 antikoerper, potassium voltage-gated channel, KQT-like subfamily, member 2a antikoerper, KCNQ2 antikoerper, Kcnq2 antikoerper, LOC100537363 antikoerper, kcnq2a antikoerper
- Hintergrund
- The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by KCNQ2 and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
- Molekulargewicht
- 44 kDa (MW of target protein)
-