SUV39H2 Antikörper

Produktnummer ABIN633133

Produktdetails anti-SUV39H2 Antikörper

Target: SUV39H2 (Suppressor of Variegation 3-9 Homolog 2 (Drosophila) (SUV39H2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUV39H2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SUV39 H2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SUV39H2 Blocking Peptide, catalog no. 33R-4870, is also available for use as a blocking control in assays to test for specificity of this SUV39H2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUV30 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUV39H2

Target: SUV39H2 (Suppressor of Variegation 3-9 Homolog 2 (Drosophila) (SUV39H2))

Andere Bezeichnung: SUV39H2 (SUV39H2 Produkte)

Synonyme: KMT1B antikoerper, 4930507K23Rik antikoerper, AA536750 antikoerper, D030054H19Rik antikoerper, D2Ertd544e antikoerper, SUV39H2 antikoerper, kmt1b antikoerper, suppressor of variegation 3-9 homolog 2 antikoerper, suppressor of variegation 3-9 homolog 2 (Drosophila) antikoerper, suppressor of variegation 3-9 homolog 2 L homeolog antikoerper, SUV39H2 antikoerper, Suv39h2 antikoerper, suv39h2 antikoerper, suv39h2.L antikoerper

Hintergrund: SUV39H2 is a histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats.

Molekulargewicht: 40 kDa (MW of target protein)