PLAT Antikörper (Middle Region)

Produktnummer ABIN632631

Produktdetails anti-PLAT Antikörper

Target: PLAT (Plasminogen Activator, Tissue (PLAT))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLAT antibody was raised against the middle region of PLAT

Aufreinigung: Affinity purified

Immunogen: PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLAT Blocking Peptide, catalog no. 33R-9356, is also available for use as a blocking control in assays to test for specificity of this PLAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLAT

Target: PLAT (Plasminogen Activator, Tissue (PLAT))

Andere Bezeichnung: PLAT (PLAT Produkte)

Synonyme: T-PA antikoerper, TPA antikoerper, AU020998 antikoerper, AW212668 antikoerper, D8Ertd2e antikoerper, tPA antikoerper, PATISS antikoerper, tpa antikoerper, Plat antikoerper, plat antikoerper, t-pa antikoerper, plasminogen activator, tissue type antikoerper, plasminogen activator, tissue antikoerper, chromosome 20 open reading frame 181 antikoerper, plasminogen activator, tissue L homeolog antikoerper, PLAT antikoerper, Plat antikoerper, plat antikoerper, C20orf181 antikoerper, plat.L antikoerper

Hintergrund: This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Autophagie, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, SARS-CoV-2 Protein Interaktom