IDH2 Antikörper

Produktnummer ABIN631096

Produktdetails anti-IDH2 Antikörper

Target: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IDH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: IDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IDH2 Blocking Peptide, catalog no. 33R-3304, is also available for use as a blocking control in assays to test for specificity of this IDH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IDH2

Target: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Andere Bezeichnung: IDH2 (IDH2 Produkte)

Synonyme: F6P23.14 antikoerper, F6P23_14 antikoerper, IDH-II antikoerper, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 2 antikoerper, isocitrate dehydrogenase II antikoerper, isocitrate dehydrogenase subunit 2 antikoerper, D2HGA2 antikoerper, ICD-M antikoerper, IDH antikoerper, IDHM antikoerper, IDP antikoerper, IDPM antikoerper, mNADP-IDH antikoerper, E430004F23 antikoerper, IDPm antikoerper, Idh-2 antikoerper, wu:fb33c06 antikoerper, wu:fk31e05 antikoerper, wu:fq43b01 antikoerper, zgc:55485 antikoerper, idh2 antikoerper, IDH2 antikoerper, isocitrate dehydrogenase subunit 2 antikoerper, isocitrate dehydrogenase (NADP(+)) 2, mitochondrial antikoerper, isocitrate dehydrogenase 2 (NADP+), mitochondrial antikoerper, isocitrate dehydrogenase 2 (NADP+), mitochondrial S homeolog antikoerper, isocitrate dehydrogenase [NADP], mitochondrial antikoerper, IDH2 antikoerper, Idh2 antikoerper, idh2.S antikoerper, idh2 antikoerper, LOC100441867 antikoerper

Hintergrund: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Warburg Effekt