PDK3 Antikörper (Middle Region)

Produktnummer ABIN631033

Produktdetails anti-PDK3 Antikörper

Target: PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PDK3 antibody was raised against the middle region of PDK3

Aufreinigung: Affinity purified

Immunogen: PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDK3 Blocking Peptide, catalog no. 33R-4222, is also available for use as a blocking control in assays to test for specificity of this PDK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDK3

Target: PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))

Andere Bezeichnung: PDK3 (PDK3 Produkte)

Synonyme: pdk3 antikoerper, PDK3 antikoerper, 2610001M10Rik antikoerper, AI035637 antikoerper, zgc:158702 antikoerper, pyruvate dehydrogenase kinase 3 antikoerper, pyruvate dehydrogenase kinase, isozyme 3a antikoerper, pyruvate dehydrogenase kinase, isoenzyme 3 antikoerper, fragile site, 5-azacytidine type, common, fra(1)(q12) antikoerper, pyruvate dehydrogenase kinase, isozyme 3b antikoerper, PDK3 antikoerper, Pdk3 antikoerper, pdk3a antikoerper, pdk3 antikoerper, FRA1J antikoerper, pdk3b antikoerper

Hintergrund: PDK3 belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. PDK3 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effekt