SDHB Antikörper

Produktnummer ABIN631009

Produktdetails anti-SDHB Antikörper

Target: SDHB (Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SDHB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SDHB Blocking Peptide, catalog no. 33R-10234, is also available for use as a blocking control in assays to test for specificity of this SDHB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDHB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SDHB

Target: SDHB (Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB))

Andere Bezeichnung: SDHB (SDHB Produkte)

Synonyme: succinate dehydrogenase 2-3 antikoerper, CG3283 antikoerper, Dmel\\CG3283 antikoerper, Ip antikoerper, SDH antikoerper, SDH-IP antikoerper, SDH-Ip antikoerper, SDHb antikoerper, sdhB antikoerper, CWS2 antikoerper, IP antikoerper, PGL4 antikoerper, SDH1 antikoerper, SDH2 antikoerper, SDHIP antikoerper, 0710008N11Rik antikoerper, fj46d06 antikoerper, wu:fj46d06 antikoerper, succinate dehydrogenase complex iron sulfur subunit B antikoerper, succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3 antikoerper, Succinate dehydrogenase, subunit B (iron-sulfur) antikoerper, succinate dehydrogenase complex subunit B, iron sulfur (Ip) antikoerper, succinate dehydrogenase complex, subunit B, iron sulfur (Ip) antikoerper, succinate dehydrogenase complex subunit B, iron sulfur (Ip) S homeolog antikoerper, SDHB antikoerper, SDH2-3 antikoerper, SdhB antikoerper, sdhb antikoerper, Sdhb antikoerper, sdhb.S antikoerper

Hintergrund: Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.

Molekulargewicht: 31 kDa (MW of target protein)