KPNA1 Antikörper

Produktnummer ABIN630936

Produktdetails anti-KPNA1 Antikörper

Target: KPNA1 (Karyopherin alpha 1 (Importin alpha 5) (KPNA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KPNA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Karyopherin Alpha 1 Blocking Peptide, catalog no. 33R-9327, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KPNA1

Target: KPNA1 (Karyopherin alpha 1 (Importin alpha 5) (KPNA1))

Andere Bezeichnung: Karyopherin alpha 1 (KPNA1 Produkte)

Synonyme: IPOA5 antikoerper, NPI-1 antikoerper, RCH2 antikoerper, SRP1 antikoerper, AW494490 antikoerper, NPI1 antikoerper, Rch2 antikoerper, mSRP1 antikoerper, si:ch211-161h7.7 antikoerper, karyopherin subunit alpha 1 antikoerper, importin alpha-1 subunit antikoerper, karyopherin (importin) alpha 1 antikoerper, karyopherin alpha 1 (importin alpha 5) antikoerper, KPNA1 antikoerper, Kpna1 antikoerper, EHI_124900 antikoerper, kpna1 antikoerper

Hintergrund: Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. KPNA1 interacts with RAG1 and may play a role in V(D)J recombination.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus