PPP2R1A Antikörper
-
- Target Alle PPP2R1A Antikörper anzeigen
- PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP2R1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL
- Top Product
- Discover our top product PPP2R1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPP2R1A Blocking Peptide, catalog no. 33R-6908, is also available for use as a blocking control in assays to test for specificity of this PPP2R1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))
- Andere Bezeichnung
- PPP2R1A (PPP2R1A Produkte)
- Synonyme
- PP2A-Aalpha antikoerper, PP2AAALPHA antikoerper, PR65A antikoerper, PR65 antikoerper, pp2a-aalpha antikoerper, pp2aaalpha antikoerper, ppp2r1a antikoerper, pr65a antikoerper, wu:fa02h04 antikoerper, zgc:56296 antikoerper, 6330556D22Rik antikoerper, PP2A antikoerper, ppp2r1a-a antikoerper, ppp2r1a-b antikoerper, protein phosphatase 2 scaffold subunit Aalpha antikoerper, protein phosphatase 2 scaffold subunit A alpha antikoerper, protein phosphatase 2 regulatory subunit A, alpha L homeolog antikoerper, protein phosphatase 2 regulatory subunit A, alpha antikoerper, protein phosphatase 2, regulatory subunit A, beta a antikoerper, serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform antikoerper, protein phosphatase 2, regulatory subunit A, alpha isoform antikoerper, protein phosphatase 2, regulatory subunit A, alpha antikoerper, protein phosphatase 2 regulatory subunit A, alpha S homeolog antikoerper, PPP2R1A antikoerper, Ppp2r1a antikoerper, ppp2r1a.L antikoerper, ppp2r1a antikoerper, ppp2r1ba antikoerper, LOC583227 antikoerper, ppp2r1a.S antikoerper
- Hintergrund
- PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division.
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signalweg, Mitotic G1-G1/S Phases, M Phase, Hepatitis C, Toll-Like Receptors Cascades
-