UNC93B1 Antikörper

Produktnummer ABIN630393

Produktdetails anti-UNC93B1 Antikörper

Target: UNC93B1 (Unc-93 Homolog B1 (UNC93B1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UNC93B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: UNC93 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UNC93B1 Blocking Peptide, catalog no. 33R-5095, is also available for use as a blocking control in assays to test for specificity of this UNC93B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC90 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UNC93B1

Target: UNC93B1 (Unc-93 Homolog B1 (UNC93B1))

Andere Bezeichnung: UNC93B1 (UNC93B1 Produkte)

Synonyme: UNC93 antikoerper, IIAE1 antikoerper, UNC93B antikoerper, Unc-93B1 antikoerper, Unc93b antikoerper, unc-93 homolog B1, TLR signaling regulator antikoerper, unc-93 homolog B1 (C. elegans) antikoerper, UNC93B1 antikoerper, Unc93b1 antikoerper

Hintergrund: UNC93B1 is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: TLR Signalweg, Activation of Innate immune Response, Toll-Like Receptors Cascades