Indian Hedgehog Antikörper

Produktnummer ABIN630306

Der Kaninchen Polyklonal anti-Indian Hedgehog Antikörper (ABIN630306) detektiert spezifisch Indian Hedgehog in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für Indian Hedgehog Antikörper (ABIN630306)

Target: Indian Hedgehog (IHH)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Indian Hedgehog Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Indian Hedgehog Antikörper

Aufreinigung: Purified

Immunogen: IHH antibody was raised using a synthetic peptide corresponding to a region with amino acids AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IHH Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this IHH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IHH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Indian Hedgehog

Target: Indian Hedgehog (IHH)

Andere Bezeichnung: IHH

Hintergrund: IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Hedgehog Signalweg