Indian Hedgehog Antikörper
-
- Target Alle Indian Hedgehog (IHH) Antikörper anzeigen
- Indian Hedgehog (IHH)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Indian Hedgehog Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- IHH antibody was raised using a synthetic peptide corresponding to a region with amino acids AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
- Top Product
- Discover our top product IHH Primärantikörper
-
anti-Indian Hedgehog (IHH) (AA 203-411) antibody
IHH Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 1-30), (N-Term) antibodyIHH Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB10375 unconjugated
anti-Indian Hedgehog (IHH) (N-Term) antibodyIHH Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio), Rind (Kuh), Ziege, Pferd WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 45-195) antibodyIHH Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Indian Hedgehog (IHH) antibodyIHH Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 119-217) antibodyIHH Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2G9 unconjugated
anti-Indian Hedgehog (IHH) (AA 24-73) antibodyIHH Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Affe, Schwein, Fledermaus, Huhn, Xenopus laevis WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 1-30) antibodyIHH Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 161-260) antibodyIHH Reaktivität: Ratte ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 380-410), (C-Term) antibodyIHH Reaktivität: Human, Ratte WB Wirt: Kaninchen Polyclonal RB51202 unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IHH Blocking Peptide, catalog no. 33R-1064, is also available for use as a blocking control in assays to test for specificity of this IHH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IHH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Indian Hedgehog (IHH)
- Andere Bezeichnung
- IHH (IHH Produkte)
- Synonyme
- BDA1 antikoerper, HHG2 antikoerper, X-hh antikoerper, Xbhh antikoerper, bhh antikoerper, bhh-a antikoerper, IHH antikoerper, ehh antikoerper, zgc:113262 antikoerper, indian hedgehog antikoerper, Indian hedgehog antikoerper, indian hedgehog S homeolog antikoerper, Indian hedgehog homolog b antikoerper, IHH antikoerper, Ihh antikoerper, ihh.S antikoerper, ihhb antikoerper
- Hintergrund
- IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg
-
