Angiotensin I Converting Enzyme 1 Antikörper

Produktnummer ABIN5693158

Produktdetails anti-Angiotensin I Converting Enzyme 1 Antikörper

Target: Angiotensin I Converting Enzyme 1 (ACE) (Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 1 (ACE))

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Angiotensin I Converting Enzyme 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Marke: Picoband™

Sequenz: AMMNYFKPLT EWLVTENRRH GETLGWPEYN WAPNTAR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Ace detection. Tested with WB in Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-Angiotensin I Converting Enzyme 1 Antikörper (ABIN5693158)

Yan, Shen: "Aliskiren has chondroprotective efficacy in a rat model of osteoarthritis through suppression of the local renin-angiotensin system." in: Molecular medicine reports, Vol. 16, Issue 4, pp. 3965-3973, (2018) (PubMed).

Details zu Angiotensin I Converting Enzyme 1

Target: Angiotensin I Converting Enzyme 1 (ACE) (Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 1 (ACE))

Andere Bezeichnung: Ace (ACE Produkte)

Synonyme: ACE1 antikoerper, CD143 antikoerper, DCP antikoerper, DCP1 antikoerper, ICH antikoerper, MVCD3 antikoerper, AW208573 antikoerper, Dcp1 antikoerper, StsRR92 antikoerper, dcp antikoerper, ace1 antikoerper, dcp1 antikoerper, xace antikoerper, cd143 antikoerper, ACE antikoerper, angiotensin I converting enzyme antikoerper, angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 antikoerper, angiotensin-converting enzyme antikoerper, angiotensin I converting enzyme (peptidyl-dipeptidase A) 3 antikoerper, angiotensin-converting enzyme-like antikoerper, ACE antikoerper, Ace antikoerper, ace antikoerper, CpipJ_CPIJ009106 antikoerper, ACE3 antikoerper, LOC101824864 antikoerper

Hintergrund:

Synonyms: Angiotensin-converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, Angiotensin-converting enzyme, soluble form, Ace, Dcp1

Tissue Specificity: Testis-specific isoform is expressed in spermatocytes, adult testis.

Background: Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies.

UniProt: P09470

Pathways: ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour, Smooth Muscle Cell Migration