HLA-DQB1 Antikörper

Produktnummer ABIN5647144

Produktdetails anti-HLA-DQB1 Antikörper

Target: HLA-DQB1 (Major Histocompatibility Complex, Class II, DQ beta 1 (HLA-DQB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HLA-DQB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR were used as the immunogen for the HLA-DQB1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HLA-DQB1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HLA-DQB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HLA-DQB1

Target: HLA-DQB1 (Major Histocompatibility Complex, Class II, DQ beta 1 (HLA-DQB1))

Andere Bezeichnung: HLA-DQB1 (HLA-DQB1 Produkte)

Synonyme: CELIAC1 antikoerper, HLA-DQB antikoerper, IDDM1 antikoerper, mhc-DRB antikoerper, DLA-DQB antikoerper, MAMU-DQB1 antikoerper, LOC100172120 antikoerper, DKFZp469C0237 antikoerper, major histocompatibility complex, class II, DQ beta 1 antikoerper, HLA-DQB1 antikoerper, PATR-DQB1 antikoerper, DLA-DQB1 antikoerper, MAMU-DQB1 antikoerper, LOC100172120 antikoerper

Hintergrund: Major histocompatibility complex, class II, DQ beta 1, also known as HLA-DQB1, is a human gene and also denotes the genetic locus that contains this gene. HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants.

UniProt: P01920

Pathways: T-Zell Rezeptor Signalweg, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints