PIAS4 Antikörper (N-Term)

Produktnummer ABIN4886695

Produktdetails anti-PIAS4 Antikörper

Target: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Bindungsspezifität: AA 130-174, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIAS4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase PIAS4(PIAS4) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: EVRLVKLPFF NMLDELLKPT ELVPQNNEKL QESPCIFALT PRQVE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase PIAS4(PIAS4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: protein inhibitor of activated STAT, 4
Protein Name: E3 SUMO-protein ligase PIAS4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PIAS4 (130-174aa EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE), different from the related mouse sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PIAS4

Target: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Andere Bezeichnung: PIAS4 (PIAS4 Produkte)

Synonyme: PIASY antikoerper, Piasg antikoerper, ZMIZ6 antikoerper, pias4 antikoerper, piasy antikoerper, wu:fc54c11 antikoerper, wu:fi18c10 antikoerper, wu:fi20e09 antikoerper, wu:fk93f11 antikoerper, zgc:66410 antikoerper, piasg antikoerper, zmiz6 antikoerper, LOC100219439 antikoerper, Pias-gamma antikoerper, pias4l antikoerper, wu:fi26h11 antikoerper, zgc:63923 antikoerper, protein inhibitor of activated STAT 4 antikoerper, protein inhibitor of activated STAT, 4 antikoerper, protein inhibitor of activated STAT, 4a antikoerper, protein inhibitor of activated STAT 4 L homeolog antikoerper, protein inhibitor of activated STAT, 4b antikoerper, PIAS4 antikoerper, Pias4 antikoerper, pias4a antikoerper, pias4.L antikoerper, pias4 antikoerper, pias4b antikoerper

Hintergrund: E3 SUMO-protein ligase PIAS4, also known as protein inhibitor of activated STAT protein 4 (PIAS4) or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.

Synonyms: E3 SUMOprotein ligase PIAS4 | E3 SUMO-protein ligase PIAS4 | PIASG | PIASgamma | PIAS-gamma | PIASy | Q8N2W9

Gen-ID: 51588

UniProt: Q8N2W9

Pathways: JAK-STAT Signalweg, Interferon-gamma Pathway, Positive Regulation of Response to DNA Damage Stimulus