ACVR2B Antikörper (C-Term)

Produktnummer ABIN4886423

Produktdetails anti-ACVR2B Antikörper

Target: ACVR2B (Activin A Receptor, Type IIB (ACVR2B))

Bindungsspezifität: AA 431-466, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACVR2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Activin receptor type-2B(ACVR2B) detection. Tested with WB in Human,Rat.

Sequenz: VVHKKMRPTI KDHWLKHPGL AQLCVTIEEC WDHDAE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Activin receptor type-2B(ACVR2B) detection. Tested with WB in Human,Rat.
Gene Name: activin A receptor type 2B
Protein Name: Activin receptor type-2B

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACVR2B (431-466aa VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ACVR2B

Target: ACVR2B (Activin A Receptor, Type IIB (ACVR2B))

Andere Bezeichnung: ACVR2B (ACVR2B Produkte)

Synonyme: ACVR2B antikoerper, XAR1 antikoerper, actr-iib antikoerper, actriib antikoerper, ACTRIIB antikoerper, ActR-IIB antikoerper, HTX4 antikoerper, ActRIIB antikoerper, actr2b antikoerper, actrIIb antikoerper, wu:fj97d11 antikoerper, activin A receptor type 2B antikoerper, activin A receptor type 2B L homeolog antikoerper, activin A receptor type 2Ba antikoerper, activin receptor IIB antikoerper, ACVR2B antikoerper, acvr2b antikoerper, acvr2b.L antikoerper, Acvr2b antikoerper, acvr2ba antikoerper

Hintergrund: Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This ACVR2B gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.

Synonyms: ActRIIB | ActR-IIB | ActR IIB | ACVR2B | ACVR-2B | ACVR 2B | HTX4 | MGC116908 | Q13705

Gen-ID: 93

UniProt: Q13705

Pathways: Hormone Transport, Cancer Immune Checkpoints