DcR1 Antikörper

Produktnummer ABIN2379279

Produktdetails anti-DcR1 Antikörper

Target: DcR1 (TNFRSF10C) (Tumor Necrosis Factor Receptor Superfamily, Member 10c (TNFRSF10C))

Reaktivität: Human

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser DcR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Flow Cytometry (FACS), Immunochromatography (IC)

Sequenz: EVPQQTVAPQ QQRHSFKGEE CPAGSHRSEH TC

Kreuzreaktivität: Human

Kreuzreaktivität (Details): Calculated cross reactivity: Hu

Produktmerkmale: TRAIL Receptor 3 (TRAIL R3, TNF-Related Apoptosis Inducing Receptor3)

Aufreinigung: Purified by immunoaffinity chromatography.

Immunogen: Synthetic peptide (EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC) corresponding to the extracellular domain sequence of human TRAIL-R3.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 1 mg/mL BSA, 0.09 % sodium azide before the addition of 40 % glycerol.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: -20°C

Details zu DcR1

Target: DcR1 (TNFRSF10C) (Tumor Necrosis Factor Receptor Superfamily, Member 10c (TNFRSF10C))

Andere Bezeichnung: TRAIL Receptor 3 (TNFRSF10C Produkte)

Synonyme: CD263 antikoerper, DCR1 antikoerper, DCR1-TNFR antikoerper, LIT antikoerper, TRAIL-R3 antikoerper, TRAILR3 antikoerper, TRID antikoerper, TNFRSF10C antikoerper, TNF receptor superfamily member 10c antikoerper, TNFRSF10C antikoerper

NCBI Accession: NP_003801

Pathways: Apoptose