IL21 Receptor Antikörper (AA 35-65)
-
- Target Alle IL21 Receptor (IL21R) Antikörper anzeigen
- IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))
-
Bindungsspezifität
- AA 35-65
-
Reaktivität
- Human, Affe
-
Wirt
- Ziege
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL21 Receptor Antikörper ist unkonjugiert
-
Applikation
- ELISA, Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Spezifität
- Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21. Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.
- Aufreinigung
- Affinity purified
- Immunogen
-
Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R. Percent identity by BLAST analysis: Human, Orangutan, Monkey (100%), Chimpanzee, Gibbon (97%).
Type of Immunogen: Synthetic peptide - Isotyp
- IgG
- Top Product
- Discover our top product IL21R Primärantikörper
-
-
- Applikationshinweise
- Approved: ELISA (1:50000), IHC, IHC-P (1:150)
- Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- PBS, 0.1 % sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store at -20°C. Avoid freeze-thaw cycles.
-
- Target
- IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))
- Andere Bezeichnung
- IL21 Receptor / IL21R (IL21R Produkte)
- Synonyme
- IL21R antikoerper, il-21ra.a antikoerper, CD360 antikoerper, NILR antikoerper, interleukin 21 receptor antikoerper, interleukin 21 receptor, tandem duplicate 1 antikoerper, IL21R antikoerper, il21r.1 antikoerper, Il21r antikoerper
- Hintergrund
-
Name/Gene ID: IL21R
Family: Interleukin
Synonyms: IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor - Gen-ID
- 50615
- UniProt
- Q9HBE5
- Pathways
- JAK-STAT Signalweg
-