anti-Human PLCD1 Antikörper für Western Blotting

Recommended PLCD1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
phospholipase C, delta 1 (PLCD1) Antikörper
  • NDNC3
  • PLC-III
  • AW212592
  • C79986
  • Plc1
  • phospholipase C delta 1
  • phospholipase C, delta 1
  • PLCD1
  • Plcd1
Epitop
N-Term
14
10
8
4
2
1
1
1
1
1
Reaktivität
Human
46
13
12
4
4
3
3
2
2
1
1
1
Wirt
Kaninchen
46
1
Klonalität
Polyklonal
Konjugat
Dieser PLCD1 Antikörper ist unkonjugiert
3
3
3
2
2
2
Applikation
Western Blotting (WB)
41
28
7
4
3
3
2
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN634399
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
16.184578 ABIN634425 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
12.434076 ABIN6388517 ELISA WB Rabbit IgG AA 90-170 Anmelden zum Anzeigen Polyclonal 0
12.434076 ABIN2149230 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.750501 ABIN5774657 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.750501 ABIN5014112 ICC IHC WB Rabbit IgG AA 1-234 Anmelden zum Anzeigen Polyclonal 0
7.750501 ABIN6001540 IF/ICC IHC IP WB Rabbit AA 1-234 Anmelden zum Anzeigen Polyclonal 0
4.750501 ABIN2786843 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
4.750501 ABIN2786844 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
4.750501 ABIN954185 EIA WB Rabbit Ig Fraction N-Term, AA 154-184 Anmelden zum Anzeigen Polyclonal 5
4.750501 ABIN656880 WB Rabbit Ig Fraction AA 134-163, N-Term Anmelden zum Anzeigen Polyclonal 0
4.750501 ABIN6264284 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.750501 ABIN2459977 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.750501 ABIN2459978 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.750501 ABIN5855256 WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.750501 ABIN2997046 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4 ABIN464048 WB Rabbit IgG AA 143-192 Anmelden zum Anzeigen Polyclonal 0
4 ABIN464047 WB Rabbit IgG AA 71-120 Anmelden zum Anzeigen Polyclonal 0
4 ABIN5530192 WB Rabbit Ig Fraction AA 134-163, N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2337221 ELISA WB Rabbit IgG N-Term, AA 154-184 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1924481 ELISA WB APC Rabbit IgG AA 134-163 Anmelden zum Anzeigen Polyclonal 0

General

Antigen phospholipase C, delta 1 (PLCD1) Antikörper
Epitop N-Term
(14), (10), (8), (4), (2), (1), (1), (1), (1), (1)
Reaktivität Human
(46), (13), (12), (4), (4), (3), (3), (2), (2), (1), (1), (1)
Wirt Kaninchen
(46), (1)
Klonalität
Polyklonal
Konjugat Dieser PLCD1 Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2)
Applikation Western Blotting (WB)
(41), (28), (7), (4), (3), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PLCD1 Antikörper

Target Details PLCD1 Anwendungsinformationen Handhabung Bilder
Spezifität PLCD1 antibody was raised against the N terminal of PLCD1
Reinigung Affinity purified
Immunogen PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ
Plasmids, Primers & others

Target Details PLCD1

Produktdetails anti-PLCD1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PLCD1 (PLCD1 Antibody Abstract)
Hintergrund Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.
Molekulargewicht 86 kDa (MW of target protein)
Pathways WNT Signalweg, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process

Anwendungsinformationen

Produktdetails anti-PLCD1 Antikörper Target Details PLCD1 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PLCD1 Blocking Peptide, catalog no. 33R-3873, is also available for use as a blocking control in assays to test for specificity of this PLCD1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PLCD1 Antikörper Target Details PLCD1 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCD1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-PLCD1 Antikörper Target Details PLCD1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-phospholipase C, delta 1 (PLCD1) (N-Term) antibody (ABIN634399) PLCD1 antibody used at 1 ug/ml to detect target protein.