anti-Human BCL9 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended BCL9 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
B-Cell CLL/lymphoma 9 (BCL9) Antikörper
  • lgs
  • xbcl9
  • legless
  • MGC83888
  • BCL9
  • 2610202E01Rik
  • 8030475K17Rik
  • A330041G23Rik
  • Gm130
  • LGS
  • B-cell CLL/lymphoma 9 L homeolog
  • B-cell CLL/lymphoma 9
  • B cell CLL/lymphoma 9
  • bcl9.L
  • BCL9
  • Bcl9
Reaktivität
Human
38
25
19
Wirt
Kaninchen
29
14
Klonalität
Polyklonal
Konjugat
Dieser BCL9 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
28
13
8
7
5
3
3
3
3
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4283625
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1711627 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1700610 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1714112 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen B-Cell CLL/lymphoma 9 (BCL9) Antikörper
Reaktivität Human
(38), (25), (19)
Wirt Kaninchen
(29), (14)
Klonalität
Polyklonal
Konjugat Dieser BCL9 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(28), (13), (8), (7), (5), (3), (3), (3), (3), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-BCL9 Antikörper

Target Details BCL9 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGPGPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFYEEKRRKQEQVVVQQCSLQD
Isotyp IgG
Plasmids, Primers & others

Target Details BCL9

Produktdetails anti-BCL9 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Bcl-9 (BCL9 Antibody Abstract)
Hintergrund Gene Symbol: BCL9
Gen-ID 607
UniProt O00512
Pathways Stem Cell Maintenance

Anwendungsinformationen

Produktdetails anti-BCL9 Antikörper Target Details BCL9 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-BCL9 Antikörper Target Details BCL9 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-BCL9 Antikörper Target Details BCL9 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-B-Cell CLL/lymphoma 9 (BCL9) antibody (ABIN4283625) Immunocytochemistry/Immunofluorescence: Bcl-9 Antibody [NBP2-30472] - Staining of hum...
Immunohistochemistry (IHC) image for anti-B-Cell CLL/lymphoma 9 (BCL9) antibody (ABIN4283625) Immunohistochemistry: Bcl-9 Antibody [NBP2-30472] - Immunohistochemical staining of h...
Immunofluorescence (IF) image for anti-B-Cell CLL/lymphoma 9 (BCL9) antibody (ABIN4283625) Immunocytochemistry/Immunofluorescence: Bcl-9 Antibody - Staining of human cell line...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-B-Cell CLL/lymphoma 9 (BCL9) antibody (ABIN4283625) Immunohistochemistry-Paraffin: Bcl-9 Antibody - Staining of human pancreas shows low...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-B-Cell CLL/lymphoma 9 (BCL9) antibody (ABIN4283625) Immunohistochemistry-Paraffin: Bcl-9 Antibody - Staining of human fallopian tube sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-B-Cell CLL/lymphoma 9 (BCL9) antibody (ABIN4283625) Immunohistochemistry-Paraffin: Bcl-9 Antibody - Staining in human fallopian tube and...