anti-Human DMPK Antikörper für Immunocytochemistry

Recommended DMPK Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Dystrophia Myotonica-Protein Kinase (DMPK) Antikörper
  • DMPK
  • DM
  • DM1
  • DM1PK
  • DMK
  • MDPK
  • MT-PK
  • Dm15
  • DM1 protein kinase
  • dystrophia myotonica-protein kinase
  • DMPK
  • Dmpk
Reaktivität
Human
76
23
18
4
3
2
2
1
1
Wirt
Kaninchen
68
10
Klonalität
Polyklonal
Konjugat
Dieser DMPK Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
61
29
13
7
5
3
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4305449
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4305450 ICC IF IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5013480 ICC IHC WB Rabbit IgG AA 1-201 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Dystrophia Myotonica-Protein Kinase (DMPK) Antikörper
Reaktivität Human
(76), (23), (18), (4), (3), (2), (2), (1), (1)
Wirt Kaninchen
(68), (10)
Klonalität
Polyklonal
Konjugat Dieser DMPK Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(61), (29), (13), (7), (5), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-DMPK Antikörper

Target Details DMPK Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVE
Isotyp IgG

Target Details DMPK

Produktdetails anti-DMPK Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung DMPK (DMPK Antibody Abstract)
Hintergrund Gene Symbol: DMPK
Gen-ID 1760
Pathways Regulation of Muscle Cell Differentiation, Synaptic Membrane, Skeletal Muscle Fiber Development

Anwendungsinformationen

Produktdetails anti-DMPK Antikörper Target Details DMPK Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-DMPK Antikörper Target Details DMPK Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-DMPK Antikörper Target Details DMPK Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Dystrophia Myotonica-Protein Kinase (DMPK) antibody (ABIN4305449) Immunohistochemistry-Paraffin: DMPK Antibody [NBP1-85010] - Staining of human skeleta...
Western Blotting (WB) image for anti-Dystrophia Myotonica-Protein Kinase (DMPK) antibody (ABIN4305449) Western Blot: DMPK Antibody [NBP1-85010] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55...
Immunofluorescence (IF) image for anti-Dystrophia Myotonica-Protein Kinase (DMPK) antibody (ABIN4305449) Immunocytochemistry/Immunofluorescence: DMPK Antibody [NBP1-85010] - Immunofluorescen...
Western Blotting (WB) image for anti-Dystrophia Myotonica-Protein Kinase (DMPK) antibody (ABIN4305449) Western Blot: DMPK Antibody - Analysis in human cell lines U-251MG and Caco-2 using ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Dystrophia Myotonica-Protein Kinase (DMPK) antibody (ABIN4305449) Immunohistochemistry-Paraffin: DMPK Antibody - Staining in human smooth muscle and l...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Dystrophia Myotonica-Protein Kinase (DMPK) antibody (ABIN4305449) Immunohistochemistry-Paraffin: DMPK Antibody - Staining of human liver shows low exp...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Dystrophia Myotonica-Protein Kinase (DMPK) antibody (ABIN4305449) Immunohistochemistry-Paraffin: DMPK Antibody - Staining of human smooth muscle shows...