Insulin Receptor Antikörper (Middle Region)
-
- Target Alle Insulin Receptor (INSR) Antikörper anzeigen
- Insulin Receptor (INSR)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Insulin Receptor Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- INSR antibody was raised against the middle region of INSR
- Aufreinigung
- Affinity purified
- Immunogen
- INSR antibody was raised using the middle region of INSR corresponding to a region with amino acids ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR
- Top Product
- Discover our top product INSR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
INSR Blocking Peptide, catalog no. 33R-2612, is also available for use as a blocking control in assays to test for specificity of this INSR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Insulin Receptor (INSR)
- Andere Bezeichnung
- INSR (INSR Produkte)
- Synonyme
- CD220 antikoerper, HHF5 antikoerper, 4932439J01Rik antikoerper, D630014A15Rik antikoerper, IR antikoerper, IR-A antikoerper, IR-B antikoerper, 18402 antikoerper, CG18402 antikoerper, DIHR antikoerper, DILR antikoerper, DIR antikoerper, DIRH antikoerper, DIRbeta antikoerper, DInR antikoerper, DInr antikoerper, Dir-a antikoerper, Dir-b antikoerper, Dmel\\CG18402 antikoerper, INR antikoerper, INS antikoerper, Inr antikoerper, Inr-alpha antikoerper, Inr-beta antikoerper, InsR antikoerper, dINR antikoerper, dIR antikoerper, dIRH antikoerper, dInR antikoerper, dInr antikoerper, dInsR antikoerper, dinr antikoerper, dir antikoerper, er10 antikoerper, inr antikoerper, insulin/insulin-like growth factor receptor antikoerper, l(3)05545 antikoerper, l(3)93Dj antikoerper, l(3)er10 antikoerper, lnR antikoerper, ir-A antikoerper, CTK-1 antikoerper, ir antikoerper, INSR antikoerper, NV14476 antikoerper, cd220 antikoerper, hhf5 antikoerper, insulin receptor antikoerper, Insulin-like receptor antikoerper, insulin receptor L homeolog antikoerper, INSR antikoerper, Insr antikoerper, InR antikoerper, LOC100122567 antikoerper, LOC100451802 antikoerper, insr.L antikoerper
- Hintergrund
- This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin.
- Molekulargewicht
- 154 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, RTK Signalweg, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity
-